SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7RFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7RFX3
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily TIMP-like 1.59e-18
Family Tissue inhibitor of metalloproteinases, TIMP 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7RFX3
Sequence length 139
Comment (tr|A7RFX3|A7RFX3_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO49676.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g237953 OC=Edwardsiidae; Nematostella.
Sequence
MSSSILGIRGVVKNETANRTEQTRVYAVAVNATLWGDIILLNTCNLSVFKPGHMVNIWTA
YDTAACGVALMVGVEYVITGYKSRMNRLSMDRCTSFIKRWDKTSPSERKTLGVCSAGSGV
GLPSMLGLAFVVILLEWIY
Download sequence
Identical sequences A7RFX3
XP_001641739.1.94760 45351.JGI237953 jgi|Nemve1|237953|estExt_fgenesh1_pg.C_20219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]