SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7S181 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7S181
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-101
Family Capz alpha-1 subunit 0.0000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7S181
Sequence length 287
Comment (tr|A7S181|A7S181_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO42588.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g242138 OC=Edwardsiidae; Nematostella.
Sequence
MADYDEPISDDEKIRIASDFIKHAPPGEFNEVFNDVRILLDNDTLLKERAASSFSDYNKE
QFTPAKLSGDEQVLITRHGELSDGSFIDPKSKQKFSYDHLRKEASNLTAQETGSTAEPWR
AAVDQAFRAYVKDHYPHGVCTVYGSSTDGLITIVACLEDHKFEPQNFWNGRWRSEWSASF
KKSGETVDMNGVLKLQVHYYEDGNVQLVSSKEIQHELKVASEAATAKNFVQNIEESENEY
QKAISENYTQMSDTTFKALRRQLPITRTKIDWNKILNYKIGQELKSS
Download sequence
Identical sequences A7S181
jgi|Nemve1|242138|estExt_fgenesh1_pg.C_570086 45351.JGI242138 XP_001634651.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]