SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7SL30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7SL30
Domain Number - Region: 2-43
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz beta-1 subunit 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7SL30
Sequence length 90
Comment (tr|A7SL30|A7SL30_NEMVE) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g122285 OC=Edwardsiidae; Nematostella.
Sequence
RVYCDTNYYGPTCGTYCIPRDDNYNGHYTCDSNTGNKICRSYWTGSNCRTPICKSGCSSV
HGFCYTPQTCECYSGWRLPDCTQCIPKPGC
Download sequence
Identical sequences A7SL30
XP_001627670.1.94760 45351.JGI122285 jgi|Nemve1|122285|e_gw.188.42.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]