SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7T120 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7T120
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-55
Family Capz beta-1 subunit 0.000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7T120
Sequence length 135
Comment (tr|A7T120|A7T120_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO30346.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g14752 OC=Edwardsiidae; Nematostella.
Sequence
TERQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKQTGKDYLL
CDYNRDGDSYRSPWSNTYDPPLDDGAVPSDRLRKLEIDANSAFDQYREMYFEGGVSSVYL
WDLDHGFAGVILIKK
Download sequence
Identical sequences A7T120
XP_001622446.1.94760 jgi|Nemve1|14752|gw.561.4.1 45351.JGI14752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]