SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7V1G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7V1G5
Domain Number - Region: 4-33
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.0112
Family DP dimerization segment 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7V1G5
Sequence length 43
Comment (tr|A7V1G5|A7V1G5_BACUC) Uncharacterized protein {ECO:0000313|EMBL:EDO54881.1} KW=Complete proteome OX=411479 OS=5828 / NCTC 13054 / VPI 0061). GN=BACUNI_01403 OC=Bacteroides.
Sequence
MTLWNDRRHFPYNRQNPYEIWDDQYFLINLQQYADEHCFSYIC
Download sequence
Identical sequences A0A139K4B1 A7V1G5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]