SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8N065 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8N065
Domain Number - Region: 130-189
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0167
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8N065
Sequence length 286
Comment (tr|A8N065|A8N065_COPC7) Uncharacterized protein {ECO:0000313|EMBL:EAU93604.2} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_02834 OC=Coprinopsis.
Sequence
MPEDTKNLYDSILQESNHLRPNPVMKLDVKFEDGGAEPIGGHMESLAEVMKYEFDKDGPF
QVEVTCTSVAAAYSEKDPADKNHINNYVMLTHDIVFAPIAHTTKHFGVTEYRVRVKPITN
INSPSGRKAYWMKHEPGQTEKLINFSKTVTHGVSVNIGFFGDGNIEFSSSVSKTISMTEP
SVRCDDHSSSGEINHSFLLTEAGAQKATHQFQLVHLASVPDEGLGDKRAKGQDDAQKLEF
ALEFEVISKLDSIRYNSVSKKHPASSVQPHPTQIFPVSAPPRPKAE
Download sequence
Identical sequences A8N065
XP_001828253.2.59657 CC1G_02834T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]