SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8NKR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8NKR0
Domain Number - Region: 228-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz alpha-1 subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8NKR0
Sequence length 436
Comment (tr|A8NKR0|A8NKR0_COPC7) Uncharacterized protein {ECO:0000313|EMBL:EAU87300.2} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_12213 OC=Coprinopsis.
Sequence
MSQTSRPSRESDKENAPPNPNASAIQSRTTRAPRRAHSEIDCSGDEGDHGDGPRESAFGL
GPRKRACRTDPLVHHGRHFGRTIQAFCRVQTLIKNGMTRSFEMQVEGITEADLSDPMERR
EHGIYKALLNLSPGLEERLCTGSDEDIFHVAEMIQKGSSSARADDTKGLKTVIIDWITPP
GQCLNPPLARNVKTDRGFYHEATGRLLCPIDEDWNDQETRELLRSGVKTVSGDQWPLLLF
KDYKYNPDNIWDGLFRSQLLVNAFKHIFTSPSSVDREPRATRSGNARIHGMTSVTIGSLA
YVATQVRFALSSSPVFSRTDLQTDSERFYESIMEAFHDPVYEVQVKALLEWWNKQIFPAQ
VGGSRPLKKGSVLARMKEQAGHPHRNRQVLGASNSQTSSSTSASTAAVADSNTPPTFGST
AQPTTSTTSQTTGPTT
Download sequence
Identical sequences A8NKR0
XP_001834524.2.59657 CC1G_12213T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]