SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8P446 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8P446
Domain Number 1 Region: 3-184,214-293
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-81
Family Capz beta-1 subunit 0.0000000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8P446
Sequence length 297
Comment (tr|A8P446|A8P446_COPC7) F-actin capping protein beta subunit {ECO:0000313|EMBL:EAU83187.1} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_07869 OC=Coprinopsis.
Sequence
MADLVDSMLDLMRRLPPTRTEENVATLVDLCPEYADDLLGSVDQPLLVKMDKATGREYLA
CDYNRDGESYRSPWSNDYDPPIEDGTVPSVKLRKLEIAANEAFDTYRELYFEGGVSSVYL
WDLEDGGFAGVVLMKKTLTPSTANEPAGSWDSIHVFETAERGRQAHYKLTSTIMLQLTTQ
SGTEKEKVKEKELKEGGGGVSEKVKGPDGLKSDGEVTLSGSMTRQTEQDWPIHDASSHIT
NTGKMIEEMEIKMRGLLQEVYFGKTRDIVYDLRSVDDLEKARRQKELQKELVGFIKR
Download sequence
Identical sequences A8P446
XP_001838678.1.59657 CC1G_07869T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]