SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8UQ58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8UQ58
Domain Number - Region: 116-169
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0128
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8UQ58
Sequence length 178
Comment (tr|A8UQ58|A8UQ58_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EDP69577.1} KW=Complete proteome; Reference proteome OX=391603 OS=Flavobacteriales bacterium ALC-1. GN=FBALC1_00445 OC=Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales.
Sequence
MNLLKKACYAIVFTGIIATTFQCASPKQVATTTFEQSTSFNVKPVSFQEWYAGIKVGGTG
INVFVPISDVKEGVTFKDVYFRNLKGKLIKKEGKYMAVLKNPSTNYTFQKPEKPADYPFT
LTDNECVLSYTENGKIKYYKIKSLNEYAGTYYENGHPTIYNKNSTDGMASLDEEESDN
Download sequence
Identical sequences A8UQ58
WP_008272399.1.13341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]