SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8X5H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8X5H1
Domain Number - Region: 101-140
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00549
Family N-terminal coiled coil domain from apc 0.0058
Further Details:      
 
Domain Number - Region: 194-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0175
Family Capz alpha-1 subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8X5H1
Sequence length 255
Comment (tr|A8X5H1|A8X5H1_CAEBR) Protein CBG07968 {ECO:0000313|EMBL:CAP27882.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG07968 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MAPAKRKLNFDNSADSTMNFEADDNFPRQWKIQGIDIDERIQRLRDELRAQGHHPAQNAV
VDPNSKFRTEYRRILTAHSIITDAIRLNQKEISWYKNATEMMANDIDALKFRREHLDKSV
EDLKNQLSNLESSVGILKSQQLAVKSVLDLREDEYMGGDDVDSNYPDDYNKFGKISKLCE
VALKSYDDVKKRTEQLQKTLMTERNRERRQRETILNGMDEKERTRVEELDEMFKDFSLDQ
LKALRDRMRIARQQN
Download sequence
Identical sequences A8X5H1
CBG07968 6238.CBG07968 XP_002646096.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]