SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8ZXV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8ZXV4
Domain Number 1 Region: 24-129
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00000146
Family Capz alpha-1 subunit 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8ZXV4
Sequence length 167
Comment (tr|A8ZXV4|A8ZXV4_DESOH) Uncharacterized protein {ECO:0000313|EMBL:ABW68581.1} KW=Complete proteome; Reference proteome OX=96561 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3). GN=Dole_2778 OC=Desulfobacteraceae; Desulfococcus.
Sequence
MQKNKHTVFWGSLFLITVVLLSCKQAAYTTEDFLGIWDSSPVFGDSEVSVQISLRAHYKK
DGAVVYSGQEVFKVGDRKATVDFEDTSRWRIDGVYLIEETIDKNYFNYNGDIELINILKK
NIEKERSQKDKTSKAKILNYQPRQKFDLLLDLGQEEKQITFHFISKS
Download sequence
Identical sequences A8ZXV4
WP_012176192.1.9016 gi|158522788|ref|YP_001530658.1| 96561.Dole_2778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]