SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9A2F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A2F9
Domain Number 1 Region: 166-224
Classification Level Classification E-value
Superfamily DNA primase core 0.00000000154
Family DNA primase DnaG catalytic core 0.0089
Further Details:      
 
Weak hits

Sequence:  A9A2F9
Domain Number - Region: 343-369
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 0.0994
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9A2F9
Sequence length 380
Comment (tr|A9A2F9|A9A2F9_NITMS) DNA primase DnaG {ECO:0000256|HAMAP-Rule:MF_00007, ECO:0000256|SAAS:SAAS00709259} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_1302 OC=Nitrosopumilus.
Sequence
MPQSGIVKYHVKLSYEVDGLVERADIIGAIFGQTEGLLGPEMNLNELQRVSKVGRIEVSA
RTTANTTAGDALIPMSTDIDTCALIAAGIESIDKVGPFDCKFTLEAIDDVRAAKKDDIVK
RAKEIKQKWATKTVSEGESMLNDVHQGDSKKLTTYGPSKLTCSSGLADSNWVILVEGRAD
VINLLRAGYDNALAIEGAKIDESIKELCNSKETVVAFLDGDRAGGFILKELKSVVPIDYE
LRADNDVEVEELTPQRIDEILSPVAEEIKGGKPAPTLQNEDDKPLAEMAAKVFPNLNETL
EAVALDGDNNEIFKVPISEVVSKLSTQSGIKYLLLDGIITQRLLEGAKNAGIECVVGHRV
AKLSNSDGMTLKTFGDLGVA
Download sequence
Identical sequences A9A2F9
gi|161528810|ref|YP_001582636.1| 436308.Nmar_1302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]