SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9A768 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A768
Domain Number 1 Region: 35-217
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.18e-56
Family Endonuclease III 0.00087
Further Details:      
 
Weak hits

Sequence:  A9A768
Domain Number - Region: 268-309
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.00418
Family GIY-YIG endonuclease 0.013
Further Details:      
 
Domain Number - Region: 222-339
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0419
Family Clostridium neurotoxins, "coiled-coil" domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9A768
Sequence length 356
Comment (tr|A9A768|A9A768_METM6) DNA-(Apurinic or apyrimidinic site) lyase {ECO:0000313|EMBL:ABX01177.1} KW=Complete proteome OX=444158 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332). GN=MmarC6_0356 OC=Methanococcaceae; Methanococcus.
Sequence
MNNTDIPFIKFLNILGENLKKDAVVDKISKNSNENERAFKILVSTVISARTKDETTAKVS
KELFKKVKSPKDLSEISVEELEKLVHPAGFYKTKAKNLKKLGEILLEKYDSKIPNSIEEL
IKLPGVGRKTANLVMTLAFDEYAICVDTHVHRITNRWNYVDTEFPENTEMELRKKLPKDY
WKRINNLLVVFGQEICSPIPKCDKCFSEIREICPHYNSLKELEKIYKDFNFKKTPKTKIP
KYKGTYVLRIKMNAPRTILVGKREIKFKKGDYFYIGSAMGDSMNLYNRISRHLSENKKKR
WHIDYLLEFSNVKEVNVTLGRFECDVSNRFNLVFDSVESFGCSDCKCKSHLYYIKP
Download sequence
Identical sequences A9A768
gi|159904747|ref|YP_001548409.1| 444158.MmarC6_0356 WP_012193152.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]