SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9L5U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9L5U0
Domain Number - Region: 5-86
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0196
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9L5U0
Sequence length 119
Comment (tr|A9L5U0|A9L5U0_SHEB9) Uncharacterized protein {ECO:0000313|EMBL:ABX49874.1} KW=Complete proteome OX=399599 OS=Shewanella baltica (strain OS195). GN=Sbal195_2706 OC=Shewanellaceae; Shewanella.
Sequence
MTEINAALAGFIKNVKQHQTLWGLMDETGEGWVVCDSSEFEDTDVMPLWSNEATAKSHCS
DEWHDYQPVAISLEEFLEYWVSDLNDDGVLIGVDWQTDEDCLELDPIVLAKDLVDVEEV
Download sequence
Identical sequences A9L5U0
gi|153001148|ref|YP_001366829.1| 399599.Sbal195_2706 402882.Shew185_2631 gi|160875818|ref|YP_001555134.1| WP_006086180.1.60405 WP_006086180.1.76213 WP_006086180.1.85636 WP_006086180.1.93117 gi|378709020|ref|YP_005273914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]