SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TJ02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TJ02
Domain Number 1 Region: 20-302
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.07e-64
Family Capz alpha-1 subunit 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9TJ02
Sequence length 314
Comment (tr|A9TJ02|A9TJ02_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ56630.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_195496 OC=Physcomitrella.
Sequence
MAHRIQGTDEEDEFEELGDEQKVAIGKWFLLNAPPGQVLQVAKDVREVLMDGRLYDRAIS
EAFPEYNVKNMISLEMPDGSGKVLLTKYGQLDSSRFLDPRTASVAIVDHVKQKCTEVRPA
DDEELPSAYVEGFRFSVDVALMKYVEEAFQGGECSVYCTKGKDLEKSRGEFELTVVISNS
SYSPKNFRNPPYRMVFGLKLIGILKKFSLLKLRAEVNAHYFEEGNVQLESSRKFNDTVVL
QDGKDAGTLIVNSIEHFESVYLSNLEEQYANLSDRTFKELRRKLPVTRTMFAWDKALQLS
LTREITREFSGNRR
Download sequence
Identical sequences A9TJ02
jgi|Phypa1_1|195496|estExt_gwp_gw1.C_2410044 XP_001778600.1.60028 3218.JGI195496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]