SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TK71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TK71
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-72
Family Capz beta-1 subunit 0.000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9TK71
Sequence length 273
Comment (tr|A9TK71|A9TK71_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ56142.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_001465 OC=Physcomitrella.
Sequence
MEAAMDIMRRMPPSLSQQALDSLLALLPAHSSELLSRSDQPLQVASDEEFDKHYLLCDYN
RDGDSYRSPWSSKYKPELEDGVQPPAELRKLEQEANEVFSIYRDQYYEGGVSSVYVWEPE
DGKGFAACVLIKKDGSDAGDGRRGLLQEGSWDAIHVIEVKEDQERQFGHYCLTSTVMLAL
TTANQATGPFSLSGSITRQMETDLALEHGHLCNMGRLIEEMESKLRNGLDQVYFGKTKEV
VFTLREPLGVLTATSHIGQSLQRRIVNDLGRSR
Download sequence
Identical sequences A9TK71
XP_001778996.1.60028 jgi|Phypa1_1|108319|estExt_fgenesh1_pm.C_2490005 PP1S249_36V6.1 PP1S249_36V6.2 3218.JGI108319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]