SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9V6Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9V6Q7
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-89
Family Capz beta-1 subunit 0.00000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9V6Q7
Sequence length 274
Comment (tr|A9V6Q7|A9V6Q7_MONBE) Predicted protein {ECO:0000313|EMBL:EDQ86776.1} KW=Complete proteome; Reference proteome OX=81824 OS=Monosiga brevicollis (Choanoflagellate). GN=33636 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Monosiga.
Sequence
MSDQQLDCALDLMRRLPPQKIEENLTGLIDLVPSLCEDLLSSIDQPLKRATDPESGRHYL
LCDYNRDGDSYRSPWSNQYYPAMDDGVVPSPELRELEIQANNAFDSYRDLYYEGGASSVY
LWDTEEDGFAGVVLIKKIGDGSKKIKGCWDSIHVFQVLEKSNGRNATYQLTSTVMLWLET
NKDGSGLMQLGGSLTRQAEQDCTVDDNNPHIANIGRMIEDMENQMRSVLNQIYFGKTKDI
VNDLRSVKSLKEAQSHMQMQKDIAAALTLRNKKN
Download sequence
Identical sequences A9V6Q7
jgi|Monbr1|33636|estExt_fgenesh2_pg.C_220060 XP_001748321.1.20067 81824.JGI33636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]