SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0E7D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0E7D9
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-84
Family Capz beta-1 subunit 0.000000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0E7D9
Sequence length 276
Comment (tr|B0E7D9|B0E7D9_ENTDS) F-actin-capping protein subunit beta, putative {ECO:0000313|EMBL:EDR29558.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_030560 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSQTDPLDYALDLMRRLPPQKVEDNLQMLIDLCPDLTDDLLSATDQPLKIVEDTTAKKSF
LICDYCRDGDSYRSPFSNKYFPAFPEGGLPSDELRQLEISLNDAFDMYREMYYEGGVHSV
YCWDIDDGFAVCVLMKKTADQSKKGNPMKGTWDSINVIEVIPKGSSKAEYRLTSTVILYM
ETDCEATGKVGFAGSLTRQNEKVLSTTQKDSHIINIGTFVEETESRMRQILDAIYFSKSK
EITNNCRCQIGVSEQNKRTLMTKQINTQLRGRHDDD
Download sequence
Identical sequences B0E7D9
XP_001734297.1.18373 XP_001737889.1.18373 jCVI|EDI_030560 jCVI|EDI_112230 gi|165899150|gb|EDR25818.1| gi|165904283|gb|EDR29558.1| gi|167377147|ref|XP_001734297.1| gi|167386749|ref|XP_001737889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]