SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0EE83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0EE83
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-87
Family Capz alpha-1 subunit 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0EE83
Sequence length 270
Comment (tr|B0EE83|B0EE83_ENTDS) F-actin-capping protein subunit alpha, putative {ECO:0000313|EMBL:EDR27162.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_171720 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MASESEKTKIVTTFLKDSPPGEFNNVLKDCREVVGDDSIFQECLPICLHDYNTEQLTVVM
DGTNPVIISKYTEQSAQEFIDPVNKKVVTFDHLSKQITSSQPLSSGLPGNDSLRQALQKK
LDNYAKEFYPKGAAIVMPKDNNTYTIIISAADFKVAQFSNGKWRSEWTITVGSKVTCEGR
IRVQVHYFEDANIQMHTDTKKKVTCNGGSEDQIAQNVIKEIKNIEDTFHAELDKIFATLS
DNCLKALRRQLPISRQKINWANWKGHKMMK
Download sequence
Identical sequences B0EE83
XP_001736588.1.18373 gi|165900951|gb|EDR27162.1| gi|167383582|ref|XP_001736588.1| jCVI|EDI_171720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]