SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0EJI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0EJI5
Domain Number - Region: 206-305
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0EJI5
Sequence length 520
Comment (tr|B0EJI5|B0EJI5_ENTDS) Uncharacterized protein {ECO:0000313|EMBL:EDR25307.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_165690 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSYKIPRSEALEINESPSRLKSSFFKIKSMASHNLHDHWGVIWGNFQTLLGEVTTKDLLT
ETHWKIPRTFKLRKEQHGSHVFLLNIMSYPDLAKRQLMMEYCQNTPRIQEIQNKIKSYGM
NQYYKSIPLKASIHVDRPTEIRIQTTHIPTYYQYEFGVQKFDENDVDIVVFTLHIPFMVT
CPTGYPVIVVDVGVYLPKGIINHKSFHDSFYDYINRIFFYYQLLNITVNKEESTNYLNEQ
LLTFIDKIDEFIQLLYSKKQYHLQLQFIYEGHSFMERARYISSIISGYLRSYYTVCIPTS
TDEINDISLLLDQFSSSTMMELHSNNLTVQINPFFTVQFVTTIESTDYFIFPFPLCLIVT
KQLSVETMKEVNIISYYASRASYFINTIDKALKLENPFPQISPIELLLPLDHEFIIEDLV
KRSIELIDKRKTLIAEYLFKEISILLMSKASILYNELLTLNIPFGKTIIEKMESCLDLQK
ADLQLIICMLKYEQPIIVAKFHEALTEALAEENQIKKNFF
Download sequence
Identical sequences B0EJI5
XP_001738365.1.18373 gi|165898459|gb|EDR25307.1| gi|167387923|ref|XP_001738365.1| jCVI|EDI_165690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]