SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0NM20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0NM20
Domain Number 1 Region: 229-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-36
Family Glutathione peroxidase-like 0.0051
Further Details:      
 
Weak hits

Sequence:  B0NM20
Domain Number - Region: 97-150
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0NM20
Sequence length 370
Comment (tr|B0NM20|B0NM20_BACSE) Antioxidant, AhpC/TSA family {ECO:0000313|EMBL:EDS16381.1} KW=Complete proteome; Reference proteome OX=449673 OS=Bacteroides stercoris ATCC 43183. GN=BACSTE_00511 OC=Bacteroides.
Sequence
MNKAMKKLTYLLAAAAVFAACNSGNKGYTVTGTVEGAADGDTVYLQTAEGRQLVKLDSAV
ITNGTFTFKGTQDSAVNRYITCQPSGKEGVLMDFFLENGAINIKLTSGEGDSATGTANND
IYQRIRDKQNELNQQMNAIYQSMSDTALTDEQREAKAKQMNDLEEQYIATAKEGIKQNIN
NAVGVFLLKKNHYYMDVEELDPLMSQIPAAYNNDETIIRIKENVEKMKATAVGQKFTDFE
MQTPEGKTVKLSDYVGKGKTVLVDFWASWCGPCRREMPNLVEAYAKYKNKNFEIVGVSLD
QSGDSWKEAIKKLNITWPQMSDLKYWNCEGAKLYAVSSIPHTVLIDGDGIILARGLHGEE
LQEKLAEVLK
Download sequence
Identical sequences B0NM20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]