SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0XIX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0XIX9
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-81
Family Capz beta-1 subunit 0.00000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0XIX9
Sequence length 258
Comment (tr|B0XIX9|B0XIX9_CULQU) F-actin capping protein subunit beta {ECO:0000313|EMBL:EDS29787.1, ECO:0000313|VectorBase:CPIJ019319-PA} KW=Complete proteome; Reference proteome OX=7176 OS=Culex quinquefasciatus (Southern house mosquito) (Culex pungens). GN=CpipJ_CPIJ019319 OC=Culicidae; Culicinae; Culicini; Culex; Culex.
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLIDLIDLAPALCEDLLTSIDQPLKIAKDKETGKDYL
LCDYNATDGSMPSERLRKLEIEANHAFDQYREMYYEGGVSSAYLWDLDHGFAGVILIKKA
GEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKRTSTAMLWLQTHKQSSGTINLGGSLTRQI
EQDAPVSESSPHIANIGRIVEDMENKIRNTLNEIYFGKTKDIVNGLRSIQSLADTNQQAA
MKKDLGAALLRRTGKGEN
Download sequence
Identical sequences B0XIX9
7176.CPIJ019319-PA XP_001869601.1.94360 CPIJ019319|F-actin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]