SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1AK85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1AK85
Domain Number 1 Region: 28-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-84
Family Capz beta-1 subunit 0.00000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1AK85
Sequence length 260
Comment (tr|B1AK85|B1AK85_HUMAN) cDNA FLJ43095 fis, clone CORDB2000541, highly similar to F-actin capping protein subunit beta {ECO:0000313|EMBL:BAG54137.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CAPZB OC=Catarrhini; Hominidae; Homo.
Sequence
MPRQFQDTGFSRPGLGQPRRCDPEPRKSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPS
LCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLR
KLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVV
EVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIG
RLVEVCADFCRQIKTRSSEE
Download sequence
Identical sequences A0A2I3SW01 B1AK85
ENSP00000264203 ENSP00000264203 ENSPTRP00000052739 ENSPTRP00000052739 gi|330864681|ref|NP_001193470.1| NP_001193470.1.87134 NP_001193470.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]