SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1AK88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1AK88
Domain Number 1 Region: 31-297
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-98
Family Capz beta-1 subunit 0.000000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1AK88
Sequence length 301
Comment (tr|B1AK88|B1AK88_HUMAN) F-actin-capping protein subunit beta {ECO:0000313|Ensembl:ENSP00000401010} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_41078 OC=Catarrhini; Hominidae; Homo.
Sequence
MHPSRRSLPFPLNCQLARVGTADYGSPSDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDL
VPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSA
RLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIA
NIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ
C
Download sequence
Identical sequences B1AK88
NP_001269091.1.87134 NP_001269091.1.92137 ENSP00000401010 ENSP00000401010 ENSP00000364286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]