SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1BBC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1BBC8
Domain Number - Region: 7-109
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1BBC8
Sequence length 147
Comment (tr|B1BBC8|B1BBC8_CLOBO) Uncharacterized protein {ECO:0000313|EMBL:EDS77202.1} KW=Complete proteome OX=445337 OS=Clostridium botulinum C str. Eklund. GN=CBC_0083 OC=Clostridium.
Sequence
MDDAYQIINLAIKNNVDTENMKKLSSDIKSKFEVPIIEEKAYEYGKYSLPSSVKIKINNE
EKKVGVVWNNANVDTSKVKVKKYTGKVQGYDREVQLNLNILPVKTVKKTVYAMGTYIKNN
KRYLKTREVEFFRDTEADMDIAERMAI
Download sequence
Identical sequences B1BBC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]