SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1BR74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1BR74
Domain Number 1 Region: 92-223
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.36e-26
Family Staphylococcal nuclease 0.00029
Further Details:      
 
Weak hits

Sequence:  B1BR74
Domain Number - Region: 35-103
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz beta-1 subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1BR74
Sequence length 237
Comment (tr|B1BR74|B1BR74_CLOPF) Thermonuclease {ECO:0000313|EMBL:EDT15784.1} KW=Complete proteome OX=451755 OS=Clostridium perfringens E str. JGS1987. GN=AC3_A0204 OC=Clostridium.
Sequence
MKKIFALIIGILIIGSTFFLVKERIVSTTKLYIDNESNSTYNDRFDKGYDGKYNKAAVED
ANKKHSKVILNKEFKVYGKENVDGATECKYIRDIDGDTIVVDLNGKKTTVRFFGVDTPED
VNPKIHCIEPYSVQAKDYVESKLQSGEIIKILFNDSKGKYGRSVGTIYYEENGKWYDLNE
EEVANGLARIAYLDQNNTNIDTKELYAAEESAKNQKLNIWSIDGYATSRGYNLAVFN
Download sequence
Identical sequences B1BR74
WP_004456505.1.90682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]