SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1C3F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1C3F0
Domain Number - Region: 11-47
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1C3F0
Sequence length 79
Comment (tr|B1C3F0|B1C3F0_9FIRM) Transposase, IS256 family {ECO:0000313|EMBL:EDS74184.1} KW=Complete proteome; Reference proteome OX=428126 OS=[Clostridium] spiroforme DSM 1552. GN=CLOSPI_01766 OC=Erysipelotrichaceae; Erysipelatoclostridium.
Sequence
MEMPRIKRNPKKVALAQAILETYNPKSVEDMNNALKDLFGPLFESMLQGEMNNHLGYSSN
DKGWYYVKKKYQLNRNFSI
Download sequence
Identical sequences B1C3F0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]