SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1IKY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1IKY2
Domain Number 1 Region: 58-154
Classification Level Classification E-value
Superfamily E set domains 3.64e-21
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Weak hits

Sequence:  B1IKY2
Domain Number - Region: 536-602
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1IKY2
Sequence length 665
Comment (tr|B1IKY2|B1IKY2_CLOBK) Uncharacterized protein {ECO:0000313|EMBL:ACA43435.1} KW=Complete proteome OX=498213 OS=Clostridium botulinum (strain Okra / Type B1). GN=CLD_1743 OC=Clostridium.
Sequence
MSKNFKILKKANALALSTAILLGVSTPVSALEKNKEEKNFNKIQLKSNSNSYVLNNSKIL
DAQTSAPSDFQLSKDNWDGSPNYTISMDMWYGTNGDAWKLYENGKLVHEVKLVNNSPNAQ
HAEVKLTNKSNGTYTYTAELINTAGVTKSKNTIVHEVTKNDAPIDVPLPESASGYPAVGY
TVLNEDDTNFEWAVFVSNPNKNYIWQGSSFSLWGMSFETDNEITSVSNAVSFKQNGKNVI
INVKQDERLLPYNTTRIFVVKGKKHSSKAPTNFKSNLIRGDISYPTFASLPSSFTKNKQD
LNEKDLITNKVDYYNPKVKANTGNKLMYNNPTSDTQLIIPIPKKMPVPINGVNGLRIWMP
SKYLAMGIGTGTEYFGLNPNFMVGLSIKENFTCGLAPLESGYTENIVTVDGQKWSWPIQK
KHPDGPFQQEKGNFNEIKKQYPDYLPDSAEHENYVTLKTGEPDDPSYVHAAMSSYMSLTM
TREFLYAIPNNDFSGVLKDAKDPWAEFVLVDNAYNRGVYGLLQKKLFTEHKDKLINSSDI
NKEFNLSGFANHIENIQNVIKAMDSETESFYDANITWDDMENYFKELRLYYGRNVPNDAD
WNIMKTDVKKAYDILSKHWGGDHISLRYDFLTLLRVCEKHLPENKQPAPSGPSWIEQVNS
ANNIH
Download sequence
Identical sequences B1IKY2
gi|170754387|ref|YP_001782437.1| WP_012340103.1.21789 498213.CLD_1743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]