SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1PZP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1PZP0
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 2.01e-88
Family Bcl-2 inhibitors of programmed cell death 0.000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1PZP0
Sequence length 171
Comment (tr|B1PZP0|B1PZP0_9GAMA) M11 protein {ECO:0000313|EMBL:ACB05761.1} OX=135748 OS=Murine herpesvirus 72. GN= OC=Gammaherpesvirinae.
Sequence
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADY
GPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMT
HFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVLPRIYSGNVIYV
Download sequence
Identical sequences B1PZP0 P89884
NP_044912.1.64638 B1PZP0_9GAMA P89884_MHV68 gi|9629595|ref|NP_044912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]