SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1RAA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1RAA5
Domain Number - Region: 19-109
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00314
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1RAA5
Sequence length 139
Comment (tr|B1RAA5|B1RAA5_CLOPF) Uncharacterized protein {ECO:0000313|EMBL:EDT22834.1} KW=Complete proteome OX=451754 OS=Clostridium perfringens B str. ATCC 3626. GN=AC1_2214 OC=Clostridium.
Sequence
MGLEIKGINNILKKLDNLSHIEKEKVVEEAAEELEKKISDKAKTFSNTSYMYVGKGEKRV
YGLSCFIDVGFSKDNAHFDLWKSLWFQNWGYFDKGLNFNGDIYINKHQFWFDETVKSSGK
EIQKQLKEKLRQEVRNALR
Download sequence
Identical sequences B1RAA5
WP_003459668.1.27537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]