SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2GUZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2GUZ5
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-117
Family Capz alpha-1 subunit 0.000000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2GUZ5
Sequence length 286
Comment (sp|B2GUZ5|CAZA1_RAT) CapZ alpha-1 {ECO:0000250|UniProtKB:P52907} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Capza1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEDVDGGLKSW
RDSCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTAKEFIKIIESAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences B2GUZ5
NP_001103095.2.100692 NP_001103095.2.4139 ENSRNOP00000052868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]