SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2W9H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2W9H2
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-80
Family Capz alpha-1 subunit 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2W9H2
Sequence length 271
Comment (tr|B2W9H2|B2W9H2_PYRTR) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EDU49550.1} KW=Complete proteome; Reference proteome OX=426418 OS=fungus) (Drechslera tritici-repentis). GN=PTRG_06630 OC=Pleosporaceae; Pyrenophora.
Sequence
MPRTAALSSFISSAPPGELTEVTKAIKSILGDDSVANELSPAFQKYNEEQFTTTKLPGGA
TEVLVSEHNSLGDGRYYDIETQSSFDFDHATGKASAVQSYVLESEQADLVKSLNKALATH
ASEHYPRSSHGVYPVPSSPSSLAILTVANKYSPTNYWNGRWRSSYIYDTTSGSITGAIKV
DVHYYEDGNVRLLTTKEVNVSVGAGAGAAEVMRKVAAEEKKYQEDLNKAFASLSEGAFKA
LRRQLPITRQKIEWEKISGYRLGQDIGGGRR
Download sequence
Identical sequences B2W9H2
XP_001936963.1.10593 PTRT_06630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]