SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3DJF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3DJF8
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 1.77e-58
Family Nucleosome core histones 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3DJF8
Sequence length 124
Comment (tr|B3DJF8|B3DJF8_DANRE) Histone H2B {ECO:0000256|RuleBase:RU000451} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:194989 OC=Cyprinidae; Danio.
Sequence
MPEPAKTAPKKGSKKAVTKTASKSGKKRRRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences B3DJF8
NP_001122231.1.45394 ENSDARP00000067948 ENSDARP00000067948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]