SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3MNF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3MNF4
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000000011
Family Co-chaperone p23-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3MNF4
Sequence length 230
Comment (tr|B3MNF4|B3MNF4_DROAN) Uncharacterized protein {ECO:0000313|EMBL:EDV32062.1} KW=Complete proteome; Reference proteome OX=7217 OS=Drosophila ananassae (Fruit fly). GN=Dana_GF14227 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVQISQTEDDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLVQEIDEMASFCRI
FKNEARIVLVKKEKGLWPEMFQKLDKETLLQKRLEIADLIVERNKKRDEMALERFDKKRR
AEIEKEIKRETAMRERLKQFQETSVRDALVVDVRKEVKTNPNPPSDRLATPLIRQPMSAI
RGSGRINVCFTTQHKRSTPKRESQSNMETAYAAAGGPNAAGNLPMESLDD
Download sequence
Identical sequences B3MNF4
7217.FBpp0117419 FBpp0117419 XP_001962841.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]