SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3T5U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B3T5U4
Domain Number - Region: 44-139
Classification Level Classification E-value
Superfamily Baseplate structural protein gp8 0.00772
Family Baseplate structural protein gp8 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3T5U4
Sequence length 240
Comment (tr|B3T5U4|B3T5U4_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:ABZ07953.1} OX=455578 OS=uncultured marine crenarchaeote HF4000_ANIW141M12. GN=ALOHA_HF4000ANIW141M12ctg1g4 OC=Archaea; Thaumarchaeota; Nitrosopumilales; environmental samples.
Sequence
MSNTEYKIKTVVLRPILDPDDAQQIVENRKTSLFRSMLQKPKKTEVHIHSLKLSYEAFLI
LSGKYNANFYRKTVHTINVEPIIREIIIGDDVFPIKKGKGVLGKLNTKIKSSTKRKNQID
LELEEHAYIDDEQEIAFDHHGKEIKMPYKMSSRLIESYPRRTLEKTKDNVKKPEITYDAA
VARLTSKLKKSVSIGRRNLEEKFTINEIIELYVPIYEARLIGPKKNVRLIRIDSIRKKVL
Download sequence
Identical sequences B3T5U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]