SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4DLY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4DLY8
Domain Number 1 Region: 82-212
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 8.82e-41
Family Bcl-2 inhibitors of programmed cell death 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4DLY8
Sequence length 238
Comment (tr|B4DLY8|B4DLY8_HUMAN) cDNA FLJ53764, highly similar to Induced myeloid leukemia cell differentiation protein Mcl-1 {ECO:0000313|EMBL:BAG59700.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAE
SITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Download sequence
Identical sequences B4DLY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]