SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4GU06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4GU06
Domain Number 1 Region: 97-242
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 2.88e-39
Family Troponin I 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4GU06
Sequence length 267
Comment (tr|B4GU06|B4GU06_DROPE) GL14173 {ECO:0000313|EMBL:EDW26026.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL14173 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MADDEKKAAAPAAAPAAAAAKPAAPAAAAAKPAAPAANGKAPAAAAAPAGPPKDPNDPKV
KAEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKK
EQERKAAERRRIIEERCGSPRNLSDASEAELQTICKQYWQRLYALEGDKFDLEHVQKVKA
QEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEE
EEKEKKPDWSKGKPGDAKVKEEVEAEA
Download sequence
Identical sequences B4GU06
XP_002022085.1.64850 FBpp0178280 FBpp0272342 7237.FBpp0272342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]