SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4H4Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4H4Y4
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-107
Family Capz alpha-1 subunit 0.0000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4H4Y4
Sequence length 286
Comment (tr|B4H4Y4|B4H4Y4_DROPE) GL10145 {ECO:0000313|EMBL:EDW32820.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL10145 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEQTQITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDALLKDGASHAFSQYNKDQL
TPVRIENSNHSAIISEFNDLGNGRFYDPRTNKAFKYDHLRKEASDYQDVEADADSEPWRA
ALDLETLAYTACHYRHGVSSVFGKSQGNQITLIICIEDHQFQPKNYWNGRWRSQWHVTFQ
AGSGLAELKGVLKVQVHYYEDGNVQLVSSKECRESVVVTNEQQMAKEVMRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences B4H4Y4
FBpp0174252 XP_002025913.1.64850 XP_017147083.1.22881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]