SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4HCQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4HCQ0
Domain Number 1 Region: 24-96
Classification Level Classification E-value
Superfamily Mitochondrial ATP synthase coupling factor 6 6.28e-23
Family Mitochondrial ATP synthase coupling factor 6 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4HCQ0
Sequence length 99
Comment (tr|B4HCQ0|B4HCQ0_DROPE) GL13184 {ECO:0000313|EMBL:EDW29390.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL13184 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MFRLCVSNFSLFCRRSIAVSAERRYKDPIYEIFLAKVKEYREKSPTGKPLDAGPEFEKEL
NETLEKLALKYGGGEGVDMLEFHKFKEPEVTLDPLSIFV
Download sequence
Identical sequences B4HCQ0
FBpp0177291 XP_002028629.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]