SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4I7I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4I7I4
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.94e-108
Family Capz alpha-1 subunit 0.0000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4I7I4
Sequence length 286
Comment (tr|B4I7I4|B4I7I4_DROSE) GM15798 {ECO:0000313|EMBL:EDW56559.1} KW=Complete proteome; Reference proteome OX=7238 OS=Drosophila sechellia (Fruit fly). GN=Dsec_GM15798 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQL
TPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRA
ALDLETLAYTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQ
AGSGTAELKGVLKVQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences B4I7I4 B4QFL0 Q9W2N0
FBpp0071461 NP_611539.1.81976 XP_002039694.1.34323 XP_002082417.1.80810 FBpp0071461 FBpp0071461 FBpp0209960 7227.FBpp0071461 FBpp0197275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]