SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4IS46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4IS46
Domain Number 1 Region: 113-164
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.000000000288
Family E2F dimerization segment 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4IS46
Sequence length 186
Comment (tr|B4IS46|B4IS46_DROPE) GL13221 {ECO:0000313|EMBL:EDW25189.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL13221 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
VKRRPQPVTDEIHPKKQAKQGLLHQTVGYQKHVVASSTPQHQEQQAQHPQHRRHHQHHEH
ELDIEDDVSERSGGKPSATQHSFVLTTPQQQLSAFSEQLIGRRSQSGRYLVGCGTSWRKI
SKEVENAGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVVSTRRVKETGFFYGLKTMF
CVQKGF
Download sequence
Identical sequences B4IS46
FBpp0177328 XP_002029454.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]