SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4LT59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LT59
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-95
Family Capz beta-1 subunit 0.00000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4LT59
Sequence length 276
Comment (tr|B4LT59|B4LT59_DROVI) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KRF81335.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ17098 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MSEMQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYL
LCDYNRDGDSYRSPWSNSYYPALEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVY
LWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTN
KQGSGTMNLGGSLTRQTEQDANVSESSPHIANIGKMVEEMENKIRNTLNAIYFGKTKDIV
NGLRSTQSLADQRDQAAMKQDLAAAILRRNVKPESN
Download sequence
Identical sequences B4LT59
7244.FBpp0231515 XP_002051735.1.90633 XP_015028241.1.90633 FBpp0231515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]