SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MDN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MDN8
Domain Number 1 Region: 158-235
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.000000000000034
Family E2F dimerization segment 0.0056
Further Details:      
 
Domain Number 2 Region: 84-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000907
Family Cell cycle transcription factor e2f-dp 0.0013
Further Details:      
 
Weak hits

Sequence:  B4MDN8
Domain Number - Region: 51-80
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0157
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4MDN8
Sequence length 369
Comment (tr|B4MDN8|B4MDN8_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW71299.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ16286 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MYKRKSGGVVPRQRITASSSSPDIDDSASGHEAESESKTYGTFHIDLPTEPQKPKIQIQQ
QQQQSTQTSQTPQPHSQQQRSVGSLVLLTQKFVELMKQNGGSIDLKEATKILDVQKRRIY
DITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDRKEYDIACERTNHLKTIEEDLDRQLEY
AQRNLHYIMQDPTNQSYAYVTRDDLLKIYGDDSVFTIPNYDEEVEIQRSDHELRVSLDNG
STIDIRLVTNQGKGTTNPNDADGPFDDRYLDTPSPSHSSDAGAGTGNVIKDEHTYSCNPE
LKEMKALETELTAKVIFQNYMAGHSLRRFYPDDPHLENPPLVQLNPPREDFNFVLKNDEG
ICELFDVQC
Download sequence
Identical sequences B4MDN8
XP_002059241.1.90633 7244.FBpp0230703 FBpp0230703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]