SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4MP99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4MP99
Domain Number - Region: 84-150
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4MP99
Sequence length 244
Comment (tr|B4MP99|B4MP99_DROWI) GK21647 {ECO:0000313|EMBL:EDW73938.1} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK21647 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEGHIKRLINGAYFDPDVLCEMEESVPYSLNIDEFWHHTLPFVHKIFVVLLTNLNTGHMK
LVYAANCCPSARTETKRFLTDSEEVAVTLLKVMYQVPPCRLKNIVALVSDRNKMNVRALE
DAEKMLGRNLPPVIFDSTQIASKFNMEKDPFTRASMEEILATLFKRESYKSQLDDIETMC
NGSNYKTLQLLWGFSTSLEKILKKVFDIDASITTFNVGHLSNDKLEAYGRSAVSQINLSF
SKLL
Download sequence
Identical sequences B4MP99
7260.FBpp0250790 FBpp0250790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]