SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4WMU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4WMU0
Domain Number 1 Region: 92-243
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00000000000379
Family MoCo biosynthesis proteins 0.018
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000025
Family PDZ domain 0.053
Further Details:      
 
Weak hits

Sequence:  B4WMU0
Domain Number - Region: 250-300
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0889
Family Capz alpha-1 subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4WMU0
Sequence length 475
Comment (tr|B4WMU0|B4WMU0_SYNS7) Putative FeS-containing Cyanobacterial-specific oxidoreductase {ECO:0000313|EMBL:EDX87444.1} KW=Complete proteome; Reference proteome OX=91464 OS=Synechococcus sp. (strain ATCC 29403 / PCC 7335). GN=S7335_5154 OC=Synechococcus.
Sequence
MKTTTLSPAKVTSVVSGSIAEEIGFEAGDRLVSVNGQRPRDLIDYRFLCADEVLNLEVID
AKGVSHQIEIEKDFDEELGLEFETALFDGLIQCVNRCPFCFIDQQPPGKRETLYLKDDDY
RLSFLYGSYLTLTNIPPAEWDRIAQLRLSPLYVSVHATEPEVRSRLLKNDRAAQILDHIR
WFQSHRLQIHAQVVVCPGINDGPHLERTLKDLAAFHTGDVPTVISAAVVPVGLTRFRPDQ
DELVPVTTAKAQEVIDQVTAIQADFQAKLGTTFAWLADEWFLMGRRSLPPEHHYESYPQI
GNGVGSIRLFLKEFDQLAQKLPAKVTPPRKVTWVVGNAVEHAFAPLVDRLNQVDGLSVDM
VAINSDYWGQEITVTGLLTGQDVARHLSRRALGDYVLLPTVMLKQGDSQRPEDTYFLDDM
SLLSLENELNCSVLSVASLSELIDACCGSTPSYMPLSRVAMSAKLNQVIDPHLLN
Download sequence
Identical sequences B4WMU0
WP_006457262.1.15510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]