SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5R7M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B5R7M3
Domain Number - Region: 66-123
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0209
Family MukF C-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5R7M3
Sequence length 179
Comment (tr|B5R7M3|B5R7M3_SALG2) Putative membrane protein {ECO:0000313|EMBL:CAR39720.1} KW=Complete proteome OX=550538 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346). GN=SG3947 OC=Enterobacteriaceae; Salmonella.
Sequence
MAHSVNLLPWRRQHYVARLRLWCVVWGASLLLIASLATIARLVFWQEGRINELLLTAENG
HTTALAANIPQLQQRQRQQQARLQRQAQRELTQDWQSILTDLANLLPEQAWLISLNYQQE
TLELEGLARTFDALLTLETSLRHYVSFPLNRTGATQQDAQGRWQFHYQLTRSAARERAL
Download sequence
Identical sequences A0A0G2NTM0 B5R7M3
WP_000951383.1.100541 WP_000951383.1.19938 WP_000951383.1.2047 WP_000951383.1.28733 WP_000951383.1.32255 WP_000951383.1.45706 550538.SG3947 gi|205354885|ref|YP_002228686.1| AM933173|CDS_4171863-4172402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]