SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5RUR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B5RUR0
Domain Number - Region: 9-95
Classification Level Classification E-value
Superfamily Ribosomal protein S7 0.017
Family Ribosomal protein S7 0.0045
Further Details:      
 
Domain Number - Region: 128-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0405
Family VPS23 C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5RUR0
Sequence length 179
Comment (tr|B5RUR0|B5RUR0_DEBHA) DEHA2G11594p {ECO:0000313|EMBL:CAR65953.1} KW=Complete proteome; Reference proteome OX=284592 OS=0083 / IGC 2968) (Yeast) (Torulaspora hansenii). GN=DEHA2G11594g OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Debaryomyces.
Sequence
MDNDDRTIKKNLTNGTYQEALEVLSRKINENLLETSKDNVNNILPEVNTNTKKIDTLYQQ
LSHHNQQACANKENLDNHISYLSNQLSSLTSLNNELIQLDGINSQKNTVSTNNKSNFELD
NLVVPDSALVNQLYDIVSEIKATKDTICLIGGNFQSESEIINDSRMDACVKAVRGLFNG
Download sequence
Identical sequences B5RUR0
XP_002770619.1.41535 4959.B5RUR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]