SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5X2H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5X2H9
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.5e-114
Family Capz alpha-1 subunit 0.000000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5X2H9
Sequence length 286
Comment (tr|B5X2H9|B5X2H9_SALSA) F-actin-capping protein subunit alpha-1 isoform X1 {ECO:0000313|RefSeq:XP_013990087.1, ECO:0000313|RefSeq:XP_013990088.1, ECO:0000313|RefSeq:XP_013990089.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=capza1 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MADFEEPLSEEEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPAKLEGYDEQVLITEHGDLGQGRFLDPRNRVSFRFDHLRKEVSDVQPYDGDSSLRAW
REACDTALSAYVKEHYPSGVCTVYGKTVDGQQTIIACIEGHQFQPKNFWNGRCRSEWKFT
IGQSTAHVVGVLKIQVHYYEDGNVQLVSHKEVEESITVTNESQTAKEFVDIIENAENDYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences B5X2H9
NP_001133577.1.97760 XP_013990087.1.97760 XP_013990088.1.97760 XP_013990089.1.97760 XP_013990090.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]