SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6FV43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6FV43
Domain Number 1 Region: 213-349
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.94e-50
Family Peptidoglycan hydrolase LytM 0.00026
Further Details:      
 
Weak hits

Sequence:  B6FV43
Domain Number - Region: 102-189
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6FV43
Sequence length 357
Comment (tr|B6FV43|B6FV43_9FIRM) Peptidase, M23 family {ECO:0000313|EMBL:EEA80111.1} KW=Complete proteome OX=500632 OS=Tyzzerella nexilis DSM 1787. GN=CLONEX_04031 OC=Tyzzerella.
Sequence
MLKKKVKKYLLISGISFAIGTLGIIFVSVLIEEVVRAIAGEEANKQITQSDLEGLPAWIT
VEMVQAAIDMMNETGYPASVVLGQMILEAGADGSELANPPYYNCLGQKAHCYKENGTVVM
RTEEAWGTVTAEFSTFANYVDCMLAWGNKFTRQPYVDNVTACKRDPVTGHYDADSFITAL
WKSGYATDPAYVSKVIAVMKSRNLYRFNYMTSADLENGLGEIGTGMFTHPCPGMTYQSSY
FGEIREFETGGHKGNDYAAPAGTPTLAAADGTVTVAGWSDSAGNWVVIDHGNGLTTKYMH
HSRLLVKTGDTVKKGQQIGEVGSTGQSTGNHLHFQVEENGVPVNPDKYLKGEGNERE
Download sequence
Identical sequences B6FV43 D4M174
WP_004614809.1.93157 gi|479155899|ref|YP_007785494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]