SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6HDZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6HDZ7
Domain Number 1 Region: 2-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-82
Family Capz alpha-1 subunit 0.00000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6HDZ7
Sequence length 273
Comment (tr|B6HDZ7|B6HDZ7_PENRW) Pc20g15430 protein {ECO:0000313|EMBL:CAP86872.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc20g15430 OC=Penicillium chrysogenum species complex.
Sequence
MASTVELASSFIEGAPPGELADVVADVQALTEGEDIVPSLLPAFKRYNEAQLAAVKLPGS
SQEVIVSGFNELEDNRYFDPESQTSFEVDHTTQTASAAQSYALESEHADLIKSLLKLFGV
HAREHYPNCSYGVYPIENDTVIAIVLVANRYSPNNFWNGRFRAIYQLPVSSSSSTLTGNI
HVDVHYYEDGNVALNTTKPVNISIPSVSAESIVSRIAAAERDYQEALNRAFVQTSEGVFK
GLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences A0A167RQ04 B6HDZ7
Pchr_Wisconsin_54-1255:Pc20g15430.t1 XP_002564015.1.37043 500485.B6HDZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]